PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0040500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 294aa    MW: 32581.3 Da    PI: 8.611
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0040500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding322.8e-102565143
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                       r rW+ eE+e+++da  ++G + Wk+I + +  ++t+ q+ +r
  ORGLA05G0040500.1 25 RERWSGEEHERFLDALILFGRD-WKRIEAFVA-TKTAIQVGHR 65
                       78******************77.*********.****999776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-91363IPR009057Homeodomain-like
PROSITE profilePS5129410.5852074IPR017930Myb domain
TIGRFAMsTIGR015578.0E-82462IPR006447Myb domain, plants
SMARTSM007171.8E-42472IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-52565IPR009057Homeodomain-like
PfamPF002494.2E-72565IPR001005SANT/Myb domain
CDDcd001678.93E-62765No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MAAMAAAAAG TKKKTRKPYT ITRPRERWSG EEHERFLDAL ILFGRDWKRI EAFVATKTAI  60
QVGHRSIDLS LCKIINGGFR IQDRVRFLDF FXFHFCLQAL IDLPWSIIQI RSHAQKHFLK  120
ARKFGLAGGL PPPLHPRRAT LLRANAAAAD MMPPPWLPSA SGGSIGCSAP PSGVQQSMAG  180
WSPACYSTDE ASFRPLIHSN DNDCSFIETP SCIGSGGESW IGDDAFFMQD ETIRLPISPD  240
DLGFAQVYKF VGDMFGSGER RPVEAHLRRL QGMDPAISET ILLMLKNLEA NLFA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638954.11e-161PREDICTED: protein REVEILLE 8
TrEMBLI1PSQ70.0I1PSQ7_ORYGL; Uncharacterized protein
STRINGORGLA05G0040500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.13e-23MYB_related family protein